- PUSL1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81876
- Human
- PBS (pH 7.2) and 40% Glycerol
- PUSL1
- 0.1 ml (also 25ul)
- Rabbit
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: WTLPADCLDM VAMQEAAQHL LGTHDFSAFQ SAGSPVPSPV RTLRRVSVSP GQASPLVTPE ESRKLRFWNL EFESQSFLY
- Unconjugated
- pseudouridine synthase like 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Immunogen affinity purified
Sequence
WTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLY
Specifications/Features
Available conjugates: Unconjugated